NCAM2 Antikörper (Middle Region)

Produktnummer ABIN635019

Dieser Anti-NCAM2 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von NCAM2 in WB. Geeignet für Human.

Kurzübersicht für NCAM2 Antikörper (Middle Region) (ABIN635019)

Target: NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NCAM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NCAM2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NCAM2 antibody was raised against the middle region of NCAM2

Aufreinigung: Affinity purified

Immunogen: NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NCAM2 Blocking Peptide, (ABIN939786), is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NCAM2

Target: NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))

Andere Bezeichnung: NCAM2

Hintergrund: The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

Molekulargewicht: 91 kDa (MW of target protein)